Home |
Search |
Today's Posts |
#1
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Hi People,
I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut. Thanks in advance, Luciano |
#2
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Did you not get the answer to this in your thread which started 28th
December? Pete |
#3
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 17 Apr 2006 04:30:48 -0700, "paulinoluciano"
wrote: Hi People, I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut. Thanks in advance, Luciano I don't know if you were the original poster in this thread. But there are various solutions posted in this thread to an identical problem. You should try them first, and then post back regarding success or problems. --ron |
#4
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Despite I have received several very good suggestions in this thread
that time they did not work very weel exactly for my problem. Therefore I would like to know if someone could help me again. A representative example of such proces can be see at http://delphi.phys.univ-tours.fr/Prolysis/cutter.html However, such engine is not as roboust as I woiuld need allowing to specify all desired rules in an Excel sheet. Thank you anyway. Luciano |
#5
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 17 Apr 2006 08:34:11 -0700, "paulinoluciano"
wrote: Despite I have received several very good suggestions in this thread that time they did not work very weel exactly for my problem. Therefore I would like to know if someone could help me again. A representative example of such proces can be see at http://delphi.phys.univ-tours.fr/Prolysis/cutter.html However, such engine is not as roboust as I woiuld need allowing to specify all desired rules in an Excel sheet. Thank you anyway. Luciano As I've written before, you can do this with Longre's add-in using Regular Expressions. B2: =REGEX.MID($A$2,"(.*?(?<!FP)(K|$)){"&COLUMNS($B:B) &"}",ROWS($B$2:B2)) copy/drag down and across for 0, 1 and 2 lost cuts. But some of your examples don't make sense to me. For example: ================ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ ======================== I don't understand how you get lines 4 and 5. Also, in your basic rules, you write: "Sequence is not cut if K is found before FP" But in your examples it seems as if your acting on a rule to "not cut if K is found AFTER FP" ========================= So far as having some variability, you could name two cells on your worksheet CutAfter Unless After In your example, CutAfter would be K UnlessAfter would be FP And the formula would be: =REGEX.MID($A$2,"(.*?(?<!"&UnlessAfter&")("&CutAft er&"|$)){"&COLUMNS($B:B)&"}",ROWS($B$2:B2)) Again, you drag down and across as far as necessary to accomodate all the "cuts" and all the "lost cuts" If these don't work, you will have to both explain more clearly, and also give examples of the results of the formulas, and the expected results. --ron |
#6
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
paulinoluciano wrote...
I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP .... The answers haven't changed since December/January. It's a near certainty no one will provide answers much different from the ones you were given then. Most of us tested our proposed solutions before we posted them to the newsgroup, so *we* can get them to work. It seems *you* couldn't get them to work. So that begs the question whether you'd be able to implement any other solutions other people provide. The odds would seem to be against that happy possibility. It'd make more sense for you to explain *IN* *DETAIL* how the solutions you received 4 months ago didn't work. I recall one issue was that you were using a Portuguese language version of Excel. Another problem was VBA. With respect to the former, if you post in English language newsgroups, translation into other languages is either up to you, or you could crosspost to the appropriate Portuguese language Excel newsgroup and hope that someone there could translate function calls (or maybe come up with another solution). For the latter, in VBA if you use the .Formula or .FormulaR1C1 properties of Range objects, Excel *automatically* translates English language function calls into local language function calls. You need to avoid using .FormulaLocal and ..FormulaR1C1Local properties to enter formulas with English function calls. |
Reply |
Thread Tools | Search this Thread |
Display Modes | |
|
|
![]() |
||||
Thread | Forum | |||
Text manipulation | Excel Worksheet Functions | |||
Using Concatenate function to generate text in Text Box | Charts and Charting in Excel | |||
merged cells into one text cell, size varies dependant on text dat | Excel Discussion (Misc queries) | |||
SUMPRODUCT vs Text??? | Excel Worksheet Functions | |||
Read Text File into Excel Using VBA | Excel Discussion (Misc queries) |