paulinoluciano wrote...
I have a sequence of characters like:

AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ

This sequence must be put in cell A2.
Thus, I have to perform some specific operations in this text:

Example 1:
Rules:
a) Fragment the sequence before K but not always (you could have lost cut).
b) Sequence is not cut if K is found before FP
....

The answers haven't changed since December/January. It's a near
certainty no one will provide answers much different from the ones you
were given then. Most of us tested our proposed solutions before we
posted them to the newsgroup, so *we* can get them to work. It seems
*you* couldn't get them to work.

So that begs the question whether you'd be able to implement any other
solutions other people provide. The odds would seem to be against that
happy possibility.

It'd make more sense for you to explain *IN* *DETAIL* how the solutions
you received 4 months ago didn't work. I recall one issue was that you
were using a Portuguese language version of Excel. Another problem was
VBA. With respect to the former, if you post in English language
newsgroups, translation into other languages is either up to you, or
you could crosspost to the appropriate Portuguese language Excel
newsgroup and hope that someone there could translate function calls
(or maybe come up with another solution). For the latter, in VBA if you
use the .Formula or .FormulaR1C1 properties of Range objects, Excel
*automatically* translates English language function calls into local
language function calls. You need to avoid using .FormulaLocal and
..FormulaR1C1Local properties to enter formulas with English function
calls.