LinkBack Thread Tools Search this Thread Display Modes
Prev Previous Post   Next Post Next
  #1   Report Post  
Posted to microsoft.public.excel.worksheet.functions
paulinoluciano
 
Posts: n/a
Default Text manipulation

Hi People,

I have a sequence of characters like:

AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ

This sequence must be put in cell A2.
Thus, I have to perform some specific operations in this text:

Example 1:
Rules:
a) Fragment the sequence before K but not always (you could have lost
cut).
b) Sequence is not cut if K is found before FP

Results:

AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ

0 lost cut = Cutting the sequence all the time in which K is present
(The subsequences of this process should be put in B column:
AASSASDK
ASASDASFAFSASASADK
ASASAFPKQREWEAQEOK
SPADAOEK
OQPPDAOPSK
AEPQ

1 lost cut = Cutting the sequence after the first K present in the
sequence (The subsequences of this process should be put in C column::
AASSASDKASASDASFAFSASASADK
ASASAFPKQREWEAQEOKSPADAOEK
OQPPDAOPSKAEPQ
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK
SPADAOEKOQPPDAOPSKAEPQ

2 lost cut = = Cutting the sequence after the second K (just for the
third and following) present in the sequence (The subsequences of this
process should be put in D column:
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK
SPADAOEKOQPPDAOPSKAEPQ

Repair that in some cases I need lost cuts in which you cut after 1, 2,
3, 4,... specific characters.
I have to specify such rules in some place of the sheet containing the
precursor text.
The rules a

Cut after "XXX" (In this example I have put K but the some cell in the
sheet must contain what is the character in which the sequence will be
fragmented). In some cases it could be more than only one character
(e.g. K and R; nor necessarily together)
Cut before "XXX" (The cut may be after like previous example or before
the character)

Never before "XXX" (In some cases I have prohibitive situations; e.g.
It must not cut a sequence in K if K is preceeded by P or by RP)
Never after "XXX" (Same for after)

Number of times that the character could be missed prior cut "XXX" (In
some place of the sheet I must explicit how many characters could be
"lost" prior cut.

Thanks in advance,
Luciano

 
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules

Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On


Similar Threads
Thread Thread Starter Forum Replies Last Post
Text manipulation paulinoluciano Excel Worksheet Functions 36 January 12th 06 09:54 AM
Using Concatenate function to generate text in Text Box Mary S. Charts and Charting in Excel 1 December 14th 05 08:55 PM
merged cells into one text cell, size varies dependant on text dat Jazzylady825 Excel Discussion (Misc queries) 0 December 9th 05 08:26 PM
SUMPRODUCT vs Text??? Ken Excel Worksheet Functions 2 April 9th 05 07:21 PM
Read Text File into Excel Using VBA Willie T Excel Discussion (Misc queries) 13 January 8th 05 12:37 AM


All times are GMT +1. The time now is 02:41 PM.

Powered by vBulletin® Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.
Copyright ©2004-2025 ExcelBanter.
The comments are property of their posters.
 

About Us

"It's about Microsoft Excel"