Home |
Search |
Today's Posts |
|
#1
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
"Is there some VBA code with which could I obtain all internal
subsequences from a text after or using some specific rules? The resulting subsequences should be expressed on consecutive cell bellow the precursor text. For example I have the text: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ Example 1: Rules: a) Cut sequence before K but not always (you could have lost cut) b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" Cut before "XXX" Never before "XXX" Never after "XXX" Number of times that the character could be missed prior cut "XXX" |
Reply |
Thread Tools | Search this Thread |
Display Modes | |
|
|
![]() |
||||
Thread | Forum | |||
Using Concatenate function to generate text in Text Box | Charts and Charting in Excel | |||
Text shown up in other cells everytime a text is entered in 1 cell | Excel Discussion (Misc queries) | |||
Finding Specific Text in a Text String | Excel Worksheet Functions | |||
SUMPRODUCT vs Text??? | Excel Worksheet Functions | |||
Read Text File into Excel Using VBA | Excel Discussion (Misc queries) |