![]() |
Text subsequences
"Is there some VBA code with which could I obtain all internal
subsequences from a text after or using some specific rules? The resulting subsequences should be expressed on consecutive cell bellow the precursor text. For example I have the text: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ Example 1: Rules: a) Cut sequence before K but not always (you could have lost cut) b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" Cut before "XXX" Never before "XXX" Never after "XXX" Number of times that the character could be missed prior cut "XXX" |
All times are GMT +1. The time now is 06:03 PM. |
Powered by vBulletin® Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.
ExcelBanter.com