On 28 Dec 2005 11:39:37 -0800, "paulinoluciano"
wrote:

1 lost cut = Cutting the sequence after the first K present in the
sequence (The subsequences of this process should be put in C column::
AASSASDKASASDASFAFSASASADK
ASASAFPKQREWEAQEOKSPADAOEK
OQPPDAOPSKAEPQ
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK
SPADAOEKOQPPDAOPSKAEPQ

See my other answer. But I did not understand how you obtained the last two
lines in the "1 lost cut" sequence.

They are identical to the two lines in the "2 lost cut" sequence, so I thought
this might be a typo. But perhaps I am missing something?


--ron

Hi Ron Rosenfeld,
Thank you very much for your help.
Could I use your first function as a VBA code?
In this second case, is is possible that we have a typo. In this case
speak about 1 lost cut means that you will cut the sequence only after
the first K appear, never to the first one. But you will have
intermediates in such process because you never now where will be
performed the first cut.
Luciano

On 29 Dec 2005 01:26:31 -0800, "paulinoluciano"
wrote:

Hi Ron Rosenfeld,
Thank you very much for your help.
Could I use your first function as a VBA code?

Yes, you can. The morefunc.xll add-in functions can be used in VBA by using
the RUN method. See HELP for those add-ins for more details.


In this second case, is is possible that we have a typo. In this case
speak about 1 lost cut means that you will cut the sequence only after
the first K appear, never to the first one. But you will have
intermediates in such process because you never now where will be
performed the first cut.

How do you determine, if you specify ONE lost cut, whether the first cut will
occur after the SECOND 'K', or after the THIRD 'K', or ???

The formulas assumed that with ONE lost cut, the first cut would occur after
the SECOND 'K'.

Here is a UDF written in VBA to do the same thing, using the REGEX.MID function
from the morefunc.xll add-in. The variables should be self-explanatory. The
return value is an array, and the individual components can be obtained using
the INDEX worksheet function.

e.g. with the sequence stored in A1:

=INDEX(SplitK($A$1,0),1) would return the first item in the '0 lost cuts'
splitting function).

===================================
Option Explicit
Function SplitK(ByVal seq As String, LostCut As Long) As Variant
Dim i As Long, j As Long
Dim KCount As Long
Dim Temp() As String

If LostCut < 0 Then
SplitK = CVErr(xlErrNum)
Exit Function
End If

KCount = Len(seq) - Len(Replace(seq, "K", ""))
ReDim Temp(1 To KCount)

For i = 1 To KCount
Temp(i) = Run([regex.mid], seq, "(\w+?([^FP]K|$)){" & LostCut + 1 & "}", i)
Next i

SplitK = Temp
End Function
=========================

This could also be written as a SUB to automatically place the results into
specified cells, but it would be less flexible.

To write results into columns B, C, D:

=====================================
Option Explicit
Sub SplitK()
Const seq As String =
"AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ"
Const MaxLostCuts As Long = 2
Const ResultColumn As Long = 2 'Column B

Dim i As Long
Dim LostCut As Long
Dim KCount As Long
Dim Temp() As String


KCount = Len(seq) - Len(Replace(seq, "K", ""))
ReDim Temp(1 To KCount)

For LostCut = 0 To MaxLostCuts
For i = 1 To KCount
Cells(i, ResultColumn + LostCut) = _
Run([regex.mid], seq, "(\w+?([^FP]K|$)){" & LostCut + 1 & "}", i)
Next i
Next LostCut

End Sub
====================================


--ron

Hi Ron,
When we are talking about "lost cut" it means that inside the sequence
will be present 1 "K" or 2 "K" or 3 "K" that will not detected in order
to be cut.
Do you understand?
Luciano

On 29 Dec 2005 05:42:15 -0800, "paulinoluciano"
wrote:

Hi Ron,
When we are talking about "lost cut" it means that inside the sequence
will be present 1 "K" or 2 "K" or 3 "K" that will not detected in order
to be cut.
Do you understand?
Luciano

I understood that to mean that if there is
ZERO lost cuts then
cut after every K (that is not preceded by an FP)

if there is ONE lost cut then
cut after every second K that is not preceded by an FP

if there are TWO lost cuts then
cut after every third K that is not preceded by an FP




--ron

Yes, it is almost this. However, since some cut is performed the
sequence to be considered to serach the next possible cut is the
remained subsequence. In such case, it could be expected any place in
the text sequence displayng two (or three) K being that the second or
third should be at the end of the sequence.
Luciano

On 29 Dec 2005 06:34:48 -0800, "paulinoluciano"
wrote:

Yes, it is almost this. However, since some cut is performed the
sequence to be considered to serach the next possible cut is the
remained subsequence. In such case, it could be expected any place in
the text sequence displayng two (or three) K being that the second or
third should be at the end of the sequence.
Luciano

I don't understand how what you are writing is different from the results that
my algorithm produces.

Perhaps if you gave some examples of the results of my formula on a text string
vs what you expect to have as a result.

For example, with ONE lost cut, and using your original seq, I get:

AASSASDKASASDASFAFSASASADK
ASASAFPKQREWEAQEOKSPADAOEK
OQPPDAOPSKAEPQ

There as been ONE cut missed in each string:

AASSASDKASASDASFAFSASASADK
^
ASASAFPKQREWEAQEOKSPADAOEK
^^^ ^
OQPPDAOPSKAEPQ
^

The FPK sequence in the second string is also not cut based on your initial
specifications.

What kind of output are you expecting from this, and why??


--ron