Reply
 
LinkBack Thread Tools Search this Thread Display Modes
  #1   Report Post  
Posted to microsoft.public.excel.worksheet.functions
Niek Otten
 
Posts: n/a
Default Text manipulation

Just out of curiosity, what not-Excel, real world problem is this?

--
Kind regards,

Niek Otten

"paulinoluciano" wrote in message
ups.com...
In fact, the other topic is just a few more complex until to explain.
Let me try explain better. I have a sequence of characters like:

AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ

This sequence must be put in cell A2.
Thus, I have to perform some specific operations in this text:

Example 1:
Rules:
a) Fragment the sequence before K but not always (you could have lost
cut).
b) Sequence is not cut if K is found before FP

Results:

AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ

0 lost cut = Cutting the sequence all the time in which K is present
(The subsequences of this process should be put in B column:
AASSASDK
ASASDASFAFSASASADK
ASASAFPKQREWEAQEOK
SPADAOEK
OQPPDAOPSK
AEPQ

1 lost cut = Cutting the sequence after the first K present in the
sequence (The subsequences of this process should be put in C column::
AASSASDKASASDASFAFSASASADK
ASASAFPKQREWEAQEOKSPADAOEK
OQPPDAOPSKAEPQ
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK
SPADAOEKOQPPDAOPSKAEPQ

2 lost cut = = Cutting the sequence after the second K (just for the
third and following) present in the sequence (The subsequences of this
process should be put in D column:
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK
SPADAOEKOQPPDAOPSKAEPQ

Repair that in some cases I need lost cuts in which you cut after 1, 2,
3, 4,... specific characters.
I have to specify such rules in some place of the sheet containing the
precursor text.
The rules a

Cut after "XXX" (In this example I have put K but the some cell in the
sheet must contain what is the character in which the sequence will be
fragmented). In some cases it could be more than only one character
(e.g. K and R; nor necessarily together)
Cut before "XXX" (The cut may be after like previous example or before
the character)

Never before "XXX" (In some cases I have prohibitive situations; e.g.
It must not cut a sequence in K if K is preceeded by P or by RP)
Never after "XXX" (Same for after)

Number of times that the character could be missed prior cut "XXX" (In
some place of the sheet I must explicit how many characters could be
"lost" prior cut (see example).



  #2   Report Post  
Posted to microsoft.public.excel.worksheet.functions
paulinoluciano
 
Posts: n/a
Default Text manipulation

Oh, Sorry! This is applied to proteomics reserch (biology). In that
case, amino acid sequences are fragmented in small parts by proteases.
There are a lot of non-Excel softwares devoted to do that but it would
be easier and nore roboust for my current applications if could I use
excel devoted to this end.
Best regards,
Luciano

  #3   Report Post  
Posted to microsoft.public.excel.worksheet.functions
Niek Otten
 
Posts: n/a
Default Text manipulation

Thanks for the info, Luciano

--
Kind regards,

Niek Otten

"paulinoluciano" wrote in message
oups.com...
Oh, Sorry! This is applied to proteomics reserch (biology). In that
case, amino acid sequences are fragmented in small parts by proteases.
There are a lot of non-Excel softwares devoted to do that but it would
be easier and nore roboust for my current applications if could I use
excel devoted to this end.
Best regards,
Luciano



Reply
Thread Tools Search this Thread
Search this Thread:

Advanced Search
Display Modes

Posting Rules

Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On


Similar Threads
Thread Thread Starter Forum Replies Last Post
Using Concatenate function to generate text in Text Box Mary S. Charts and Charting in Excel 1 December 14th 05 08:55 PM
merged cells into one text cell, size varies dependant on text dat Jazzylady825 Excel Discussion (Misc queries) 0 December 9th 05 08:26 PM
Text shown up in other cells everytime a text is entered in 1 cell bioyyy Excel Discussion (Misc queries) 1 August 26th 05 05:26 PM
SUMPRODUCT vs Text??? Ken Excel Worksheet Functions 2 April 9th 05 07:21 PM
Read Text File into Excel Using VBA Willie T Excel Discussion (Misc queries) 13 January 8th 05 12:37 AM


All times are GMT +1. The time now is 02:48 AM.

Powered by vBulletin® Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.
Copyright ©2004-2025 ExcelBanter.
The comments are property of their posters.
 

About Us

"It's about Microsoft Excel"