Home |
Search |
Today's Posts |
#1
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
"Is there some VBA code which could delete all first, second or third
characters of a text? Could it be done to the three last characters from this same text and these be displayed on reverse order?" Example: AAAASAHDASK AAASAHDASK AASAHDASK ASAHDASK SADHASAAAA ADHASAAAA DHASAAAA |
#2
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
I'm guessing you could use the LEFT, MID and RIGHT functions, but I've not
used them in VBA. "paulinoluciano" wrote in message ups.com... "Is there some VBA code which could delete all first, second or third characters of a text? Could it be done to the three last characters from this same text and these be displayed on reverse order?" Example: AAAASAHDASK AAASAHDASK AASAHDASK ASAHDASK SADHASAAAA ADHASAAAA DHASAAAA |
#3
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
You are right Barb Reinhardt... But in this case I would need to use
some kind of VBA code because I would not like to have to put each sequence o characters and functions for each cell independently. I would like to perform an automatic approach because I have a lot of files to do that. Thank you anyway! Luciano |
#4
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Sub Test()
Dim iLastRow As Long Dim i As Long, j As Long Dim temp Const nIndex As Long = 3 'every third, change to suit iLastRow = Cells(Rows.Count, "A").End(xlUp).Row For i = 1 To iLastRow If nIndex = 1 Then Cells(i, "A").Value = Right(Cells(i, "A").Value, _ Len(Cells(i, "A").Value) - 1) Else Cells(i, "A").Value = Left(Cells(i, "A").Value, nIndex - 1) & _ Right(Cells(i, "A").Value, Len(Cells(i, "A").Value) - nIndex) End If Next i End Sub -- HTH Bob Phillips (remove nothere from email address if mailing direct) "paulinoluciano" wrote in message ups.com... "Is there some VBA code which could delete all first, second or third characters of a text? Could it be done to the three last characters from this same text and these be displayed on reverse order?" Example: AAAASAHDASK AAASAHDASK AASAHDASK ASAHDASK SADHASAAAA ADHASAAAA DHASAAAA |
#5
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Thank you Bob Phillips! It solve my problem in part. However the major
question is just a few more complex. I explained it better in topic Text subsequences. In the present topic instead subtract one letter any time I need a macro capable to let the first cell (e.g. A1) as it is and remove the characters only in the next row (A2) that it would be identical to the previous without the first letter. Luciano |
#6
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
I didn't understand the other one!
-- HTH Bob Phillips (remove nothere from email address if mailing direct) "paulinoluciano" wrote in message oups.com... Thank you Bob Phillips! It solve my problem in part. However the major question is just a few more complex. I explained it better in topic Text subsequences. In the present topic instead subtract one letter any time I need a macro capable to let the first cell (e.g. A1) as it is and remove the characters only in the next row (A2) that it would be identical to the previous without the first letter. Luciano |
#7
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
In fact, the other topic is just a few more complex until to explain.
Let me try explain better. I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut (see example). |
#8
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Just out of curiosity, what not-Excel, real world problem is this?
-- Kind regards, Niek Otten "paulinoluciano" wrote in message ups.com... In fact, the other topic is just a few more complex until to explain. Let me try explain better. I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut (see example). |
#9
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Oh, Sorry! This is applied to proteomics reserch (biology). In that
case, amino acid sequences are fragmented in small parts by proteases. There are a lot of non-Excel softwares devoted to do that but it would be easier and nore roboust for my current applications if could I use excel devoted to this end. Best regards, Luciano |
#10
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Thanks for the info, Luciano
-- Kind regards, Niek Otten "paulinoluciano" wrote in message oups.com... Oh, Sorry! This is applied to proteomics reserch (biology). In that case, amino acid sequences are fragmented in small parts by proteases. There are a lot of non-Excel softwares devoted to do that but it would be easier and nore roboust for my current applications if could I use excel devoted to this end. Best regards, Luciano |
#11
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 28 Dec 2005 11:39:37 -0800, "paulinoluciano"
wrote: In fact, the other topic is just a few more complex until to explain. Let me try explain better. I have a sequence of characters like: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ This sequence must be put in cell A2. Thus, I have to perform some specific operations in this text: Example 1: Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut (see example). You may want to look into "regular expressions" to do what you are trying to describe. If you download and install Longre's free morefunc.xll add-in from http://xcell05.free.fr/ you will see that you can use them as worksheet functions and also call them from a VBA module. What you write is a bit confusing. For example, one rule you give is: "Sequence is not cut if K is found before FP" but in your example you seem to be acting as if the rule applies if K is found AFTER FP. I am assuming the output starts in B1; if it starts in a different row, then adjust the ROW() function to result in a 1 as the output: seq is the character sequence (Insert/Name/Define and set seq = "your string") For the "0 lost cuts" B1: =REGEX.MID(seq,"(\w+?([^FP]K|$)){"&COLUMN()-1&"}",ROW()) ROW() resolves to a '1' which means take the 'first' sequence that matches the pattern. As you copy/drag the formula down, ROW() will resolve to '2', '3', etc. which means match the 2nd, 3rd, etc sequence that matches the pattern. The basic pattern is defined by "(\w+?([^FP]K|$)){" which means look for a sequence of letters that ends with a K that is not preceded by an FP, or that is at the end of the string. The {"&COLUMN()-1&"}" resolves, in Column B, to {1} which means look for one occurrence of the preceding pattern. If you copy/drag the formula down until you get blanks for the results, you will see what you posted in your previous message. If you copy/drag across to column D, you will see the results of "1 lost cut" or "2 lost cuts". I think once you understand the formula construction and the regular expressions, it will be simple to use this for your other rules. Without the COLUMN and ROW functions, the formulas would look like: B1: =REGEX.MID(seq,"(\w+?([^FP]K|$)){1}",1) B2: =REGEX.MID(seq,"(\w+?([^FP]K|$)){1}",2) C1: =REGEX.MID(seq,"(\w+?([^FP]K|$)){2}",1) C2: =REGEX.MID(seq,"(\w+?([^FP]K|$)){2}",2) To use this in VBA, you would use the RUN method which is outlined in HELP for morefunc.xll --ron |
#12
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 28 Dec 2005 11:39:37 -0800, "paulinoluciano"
wrote: 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ See my other answer. But I did not understand how you obtained the last two lines in the "1 lost cut" sequence. They are identical to the two lines in the "2 lost cut" sequence, so I thought this might be a typo. But perhaps I am missing something? --ron |
#13
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Hi Ron Rosenfeld,
Thank you very much for your help. Could I use your first function as a VBA code? In this second case, is is possible that we have a typo. In this case speak about 1 lost cut means that you will cut the sequence only after the first K appear, never to the first one. But you will have intermediates in such process because you never now where will be performed the first cut. Luciano |
#14
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 01:26:31 -0800, "paulinoluciano"
wrote: Hi Ron Rosenfeld, Thank you very much for your help. Could I use your first function as a VBA code? Yes, you can. The morefunc.xll add-in functions can be used in VBA by using the RUN method. See HELP for those add-ins for more details. In this second case, is is possible that we have a typo. In this case speak about 1 lost cut means that you will cut the sequence only after the first K appear, never to the first one. But you will have intermediates in such process because you never now where will be performed the first cut. How do you determine, if you specify ONE lost cut, whether the first cut will occur after the SECOND 'K', or after the THIRD 'K', or ??? The formulas assumed that with ONE lost cut, the first cut would occur after the SECOND 'K'. Here is a UDF written in VBA to do the same thing, using the REGEX.MID function from the morefunc.xll add-in. The variables should be self-explanatory. The return value is an array, and the individual components can be obtained using the INDEX worksheet function. e.g. with the sequence stored in A1: =INDEX(SplitK($A$1,0),1) would return the first item in the '0 lost cuts' splitting function). =================================== Option Explicit Function SplitK(ByVal seq As String, LostCut As Long) As Variant Dim i As Long, j As Long Dim KCount As Long Dim Temp() As String If LostCut < 0 Then SplitK = CVErr(xlErrNum) Exit Function End If KCount = Len(seq) - Len(Replace(seq, "K", "")) ReDim Temp(1 To KCount) For i = 1 To KCount Temp(i) = Run([regex.mid], seq, "(\w+?([^FP]K|$)){" & LostCut + 1 & "}", i) Next i SplitK = Temp End Function ========================= This could also be written as a SUB to automatically place the results into specified cells, but it would be less flexible. To write results into columns B, C, D: ===================================== Option Explicit Sub SplitK() Const seq As String = "AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ" Const MaxLostCuts As Long = 2 Const ResultColumn As Long = 2 'Column B Dim i As Long Dim LostCut As Long Dim KCount As Long Dim Temp() As String KCount = Len(seq) - Len(Replace(seq, "K", "")) ReDim Temp(1 To KCount) For LostCut = 0 To MaxLostCuts For i = 1 To KCount Cells(i, ResultColumn + LostCut) = _ Run([regex.mid], seq, "(\w+?([^FP]K|$)){" & LostCut + 1 & "}", i) Next i Next LostCut End Sub ==================================== --ron |
#15
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Hi Ron,
When we are talking about "lost cut" it means that inside the sequence will be present 1 "K" or 2 "K" or 3 "K" that will not detected in order to be cut. Do you understand? Luciano |
#16
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 05:42:15 -0800, "paulinoluciano"
wrote: Hi Ron, When we are talking about "lost cut" it means that inside the sequence will be present 1 "K" or 2 "K" or 3 "K" that will not detected in order to be cut. Do you understand? Luciano I understood that to mean that if there is ZERO lost cuts then cut after every K (that is not preceded by an FP) if there is ONE lost cut then cut after every second K that is not preceded by an FP if there are TWO lost cuts then cut after every third K that is not preceded by an FP --ron |
#17
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Yes, it is almost this. However, since some cut is performed the
sequence to be considered to serach the next possible cut is the remained subsequence. In such case, it could be expected any place in the text sequence displayng two (or three) K being that the second or third should be at the end of the sequence. Luciano |
#18
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 06:34:48 -0800, "paulinoluciano"
wrote: Yes, it is almost this. However, since some cut is performed the sequence to be considered to serach the next possible cut is the remained subsequence. In such case, it could be expected any place in the text sequence displayng two (or three) K being that the second or third should be at the end of the sequence. Luciano I don't understand how what you are writing is different from the results that my algorithm produces. Perhaps if you gave some examples of the results of my formula on a text string vs what you expect to have as a result. For example, with ONE lost cut, and using your original seq, I get: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ There as been ONE cut missed in each string: AASSASDKASASDASFAFSASASADK ^ ASASAFPKQREWEAQEOKSPADAOEK ^^^ ^ OQPPDAOPSKAEPQ ^ The FPK sequence in the second string is also not cut based on your initial specifications. What kind of output are you expecting from this, and why?? --ron |
#19
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
It is exactly this I`m waiting for. However I could not apply your
algorithm yet. It is telling me that are an error: "Run-time error '1004': Method 'Run' of object'_Global' failed". I did not understand what is happening. Regards, Luciano |
#20
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 11:03:06 -0800, "paulinoluciano"
wrote: It is exactly this I`m waiting for. However I could not apply your algorithm yet. It is telling me that are an error: "Run-time error '1004': Method 'Run' of object'_Global' failed". I did not understand what is happening. Regards, Luciano 1. Perhaps you did not follow all of the instructions. 2. Perhaps there is a problem with line-wrapping in your newsgroup reader, so that coding is not copied precisely as I posted. Suggestion: Write me exactly what you did to reproduce what I recommended. Copy/Paste the code you are using into your post. --ron |
#21
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Bob Phillips wrote...
.... If nIndex = 1 Then Cells(i, "A").Value = Right(Cells(i, "A").Value, _ Len(Cells(i, "A").Value) - 1) Else Cells(i, "A").Value = Left(Cells(i, "A").Value, nIndex - 1) & _ Right(Cells(i, "A").Value, Len(Cells(i, "A").Value) - nIndex) End If .... Could simplify: Right(x, Len(x) - y) == Mid(x, y + 1) Then again, the whole If block could be replaced by Cells(i, "A").Value = _ Application.WorksheetFunction.Replace(Cells(i, "A").Value, nIndex, 1, "") |
#22
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
paulinoluciano wrote...
.... AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADA OEKOQPPDAOPSKAEPQ This sequence must be put in cell A2. .... Rules: a) Fragment the sequence before K but not always (you could have lost cut). b) Sequence is not cut if K is found before FP Results: ASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAO EKOQPPDAOPSKAEPQ 0 lost cut = Cutting the sequence all the time in which K is present (The subsequences of this process should be put in B column: AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ You could use formulas. B2: =LEFT($A$2,FIND("K",SUBSTITUTE($A$2,"FPK","###"))) B3: =REPLACE(LEFT($A$2,FIND("K",SUBSTITUTE($A$2,"FPK", "###")&"K", SUMPRODUCT(LEN(B$2:B2))+1)),1,SUMPRODUCT(LEN(B$2:B 2)),"") Fill B3 down as needed. Filling it into B4:B8 (one cell more than needed) gives B2:B8 AASSASDK ASASDASFAFSASASADK ASASAFPKQREWEAQEOK SPADAOEK OQPPDAOPSK AEPQ <blank 1 lost cut = Cutting the sequence after the first K present in the sequence (The subsequences of this process should be put in C column:: AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ You have all the information you need for this in column B. C2: =INDEX(B$2:B$99,2*ROWS(C$2:C2)-1)&INDEX(B$2:B$99,2*ROWS(C$2:C2)) Fill C2 down as needed. Filling it into C3:C5 (one more than needed) gives C2:C5 AASSASDKASASDASFAFSASASADK ASASAFPKQREWEAQEOKSPADAOEK OQPPDAOPSKAEPQ <blank 2 lost cut = = Cutting the sequence after the second K (just for the third and following) present in the sequence (The subsequences of this process should be put in D column: AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ D2: =INDEX(B$2:B$99,3*ROWS(D$2:D2)-2)&INDEX(B$2:B$99,3*ROWS(D$2:D2)-1) &INDEX(B$2:B$99,3*ROWS(D$2:D2)) Fill D2 down as needed. Filling it into D3:D4 (one more than needed) gives D2:D4 AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOK SPADAOEKOQPPDAOPSKAEPQ <blank Repair that in some cases I need lost cuts in which you cut after 1, 2, 3, 4,... specific characters. I have to specify such rules in some place of the sheet containing the precursor text. The rules a Cut after "XXX" (In this example I have put K but the some cell in the sheet must contain what is the character in which the sequence will be fragmented). In some cases it could be more than only one character (e.g. K and R; nor necessarily together) Cut before "XXX" (The cut may be after like previous example or before the character) Never before "XXX" (In some cases I have prohibitive situations; e.g. It must not cut a sequence in K if K is preceeded by P or by RP) The RP preceding K is redundant if P alone preceding K indicates a prohibited situation. You'd only need to check for PK. Never after "XXX" (Same for after) Number of times that the character could be missed prior cut "XXX" (In some place of the sheet I must explicit how many characters could be "lost" prior cut (see example). Generalizing the formulas above with the character to match in a cell named CC and the prohibited sequence (in this case FPK) in a cell named PS, B2: =LEFT($A$2,FIND(CC,SUBSTITUTE($A$2,PS,REPT("#",LEN (PS))))) B3: =REPLACE(LEFT($A$2,FIND(CC,SUBSTITUTE($A$2,PS,REPT ("#",LEN(PS)))&CC, SUMPRODUCT(LEN(B$2:B2))+1)),1,SUMPRODUCT(LEN(B$2:B 2)),"") The column C, D, etc. formulas wouldn't need to change. If you have multiple prohibited sequences, then regular expressions would be MUCH BETTER tools for doing this. Symbolic processing like this is reducible to text processing, but Excel provides poor built-in tools for text processing, but since it was meant to calculate numbers this shouldn't be surprising. |
#23
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Dear Harlan Grove,
Thank you very much for your attention. I have tried apply your formulas but my excel related some problems. The message is that: "The formula you typed contains an error". In addition, do you think that would it be possible to perform such formulas by using VBA? Luciano |
#24
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Ron Rosenfeld wrote...
.... For the "0 lost cuts" B1: =REGEX.MID(seq,"(\w+?([^FP]K|$)){"&COLUMN()-1&"}",ROW()) ROW() resolves to a '1' which means take the 'first' sequence that matches the pattern. As you copy/drag the formula down, ROW() will resolve to '2', '3', etc. which means match the 2nd, 3rd, etc sequence that matches the pattern. The basic pattern is defined by "(\w+?([^FP]K|$)){" which means look for a sequence of letters that ends with a K that is not preceded by an FP, or that is at the end of the string. .... Wrong. [^FP] means any characters other than F or P, not the sequence FP. While your formula may have produced the OP's expected results, if there were an "FK" in the sequence, it wouldn't have. You need to use a negative look-ahead asertion. B2: =REGEX.MID($A$2,"([^K]?|.*?((?!FP)..))K",ROWS(B$2:B2)) Note that if 0, 1, 2, etc. cuts are always wanted, the 1, 2, etc. cuts could all be generated from the 0 cuts by concatenating each group of 2, 3, etc. 0-cut items, respectively. If there could be multiple prohibited sequences, e.g., never cut before FPK or DK (note the different lengths), it actually gets simpler if you use an inner REGEX.SUBSTITUTE call to mask the cut character (K) ending prohibited sequences, then unmask it after the REGEX.MID calls. B2: =SUBSTITUTE(REGEX.MID(REGEX.SUBSTITUTE($A$2,"(FP|D )K","[1]_"), ".*?K",ROWS(B$10:B10)),"_","K") If the cut character were named CC, the list of prohibited sequences - not including the ending cut character - were named PS, then this could be rewritten as B2: =SUBSTITUTE(REGEX.MID(REGEX.SUBSTITUTE($A$2,"("&MC ONCAT(PS,"|")&")"&CC, "[1]#"),".*?"&CC,ROWS(B$10:B10)),"#",CC) making use if MOREFUNC.XLL's MCONCAT function as well. If you REALLY want to learn regular expressions, read comp.lang.perl.misc, comp.editors or comp.unix.shell. Then when you THINK you know them, reply to threads in those ngs. You'll find out VERY QUICKLY whether you know them or not. |
#25
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Thank you very much Harlan Grove!
In fact, I just realize that it was just a language problem. My excel has formula in portuguese; different from yours. I`m now trying put your formula to run as VBA codes but in this case I think it will be necessary to define each variable because some people will use thes worksheet will not have morefunc.xll. Luciano |
#26
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]() paulinoluciano wrote: Thank you very much Harlan Grove! In fact, I just realize that it was just a language problem. My excel has formula in portuguese; different from yours. I`m now trying put your formula to run as VBA codes but in this case I think it will be necessary to define each variable because some people will use thes worksheet will not have morefunc.xll. Luciano |
#27
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 14:08:41 -0800, "Harlan Grove" wrote:
Ron Rosenfeld wrote... ... For the "0 lost cuts" B1: =REGEX.MID(seq,"(\w+?([^FP]K|$)){"&COLUMN()-1&"}",ROW()) ROW() resolves to a '1' which means take the 'first' sequence that matches the pattern. As you copy/drag the formula down, ROW() will resolve to '2', '3', etc. which means match the 2nd, 3rd, etc sequence that matches the pattern. The basic pattern is defined by "(\w+?([^FP]K|$)){" which means look for a sequence of letters that ends with a K that is not preceded by an FP, or that is at the end of the string. ... Wrong. [^FP] means any characters other than F or P, not the sequence FP. While your formula may have produced the OP's expected results, if there were an "FK" in the sequence, it wouldn't have. You need to use a negative look-ahead asertion. B2: =REGEX.MID($A$2,"([^K]?|.*?((?!FP)..))K",ROWS(B$2:B2)) Note that if 0, 1, 2, etc. cuts are always wanted, the 1, 2, etc. cuts could all be generated from the 0 cuts by concatenating each group of 2, 3, etc. 0-cut items, respectively. If there could be multiple prohibited sequences, e.g., never cut before FPK or DK (note the different lengths), it actually gets simpler if you use an inner REGEX.SUBSTITUTE call to mask the cut character (K) ending prohibited sequences, then unmask it after the REGEX.MID calls. B2: =SUBSTITUTE(REGEX.MID(REGEX.SUBSTITUTE($A$2,"(FP| D)K","[1]_"), ".*?K",ROWS(B$10:B10)),"_","K") If the cut character were named CC, the list of prohibited sequences - not including the ending cut character - were named PS, then this could be rewritten as B2: =SUBSTITUTE(REGEX.MID(REGEX.SUBSTITUTE($A$2,"("&M CONCAT(PS,"|")&")"&CC, "[1]#"),".*?"&CC,ROWS(B$10:B10)),"#",CC) making use if MOREFUNC.XLL's MCONCAT function as well. If you REALLY want to learn regular expressions, read comp.lang.perl.misc, comp.editors or comp.unix.shell. Then when you THINK you know them, reply to threads in those ngs. You'll find out VERY QUICKLY whether you know them or not. Thank you for pointing that out. And also for the references to those other NG's. --ron |
#28
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 14:08:41 -0800, "Harlan Grove" wrote:
B2: =REGEX.MID($A$2,"([^K]?|.*?((?!FP)..))K",ROWS(B$2:B2)) By the way, I think in keeping with the OP's specifications, this should be: =REGEX.MID(seq,"([^K]?|.*?((?!FP)..))(K|$)",ROWS(B$2:B2)) I think he always wants the end of the string, even if it doesn't end with a 'K'. --ron |
#29
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Ron Rosenfeld wrote...
.... By the way, I think in keeping with the OP's specifications, this should be: =REGEX.MID(seq,"([^K]?|.*?((?!FP)..))(K|$)",ROWS(B$2:B2)) I think he always wants the end of the string, even if it doesn't end with a 'K'. Good point, but it begs the question whether any symbols after the last K would be considered valid data. |
#30
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 30 Dec 2005 11:04:25 -0800, "Harlan Grove" wrote:
Ron Rosenfeld wrote... ... By the way, I think in keeping with the OP's specifications, this should be: =REGEX.MID(seq,"([^K]?|.*?((?!FP)..))(K|$)",ROWS(B$2:B2)) I think he always wants the end of the string, even if it doesn't end with a 'K'. Good point, but it begs the question whether any symbols after the last K would be considered valid data. It's been a long time since I was fragmenting amino acid sequences ... --ron |
#31
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 29 Dec 2005 14:08:41 -0800, "Harlan Grove" wrote:
Wrong. [^FP] means any characters other than F or P, not the sequence FP. While your formula may have produced the OP's expected results, if there were an "FK" in the sequence, it wouldn't have. You need to use a negative look-ahead asertion. B2: =REGEX.MID($A$2,"([^K]?|.*?((?!FP)..))K",ROWS(B$2:B2)) Harlan, How about a negative look-behind assertion? =REGEX.MID($A$1,".*?(?<!FP)(K|$)",ROWS($B$2:B2)) --ron |
#32
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
"Ron Rosenfeld" wrote...
.... How about a negative look-behind assertion? =REGEX.MID($A$1,".*?(?<!FP)(K|$)",ROWS($B$2:B2) ) I keep forgetting Longre uses PCRE rather than VBScript regexp syntax. Too many regexp varieties. That should work for one literal substring in the assertion, but multiple options, e.g., ".+?(?<!(FP|XYZ|D))K" [note: it's more efficient to append a K to A1 and use a simple K at the end of the regexp than to use (K|$) - to me at least that's a clearer indicator that trailing symbols after the last K should be included] could cause backtracking problems. Assertions with alternation subexpressions with closures (not the case here, but generally) can become a big PITA. If there were multiple prohibited sequences, it may be more efficient to mask immediately following cut characters and replace them in the results. This is the regexp analog to using ancillary cells for intermediate calculations rather than single huge formulas in spreadsheets. Just as 2 or 3 formulas may recalc more quickly than a single equivalent formula, 2 or 3 simpler regexp operations may recalc more quickly than a single, more complex one. Assertions may work well in this case, but I tend to avoid them when possible myself. |
#33
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On Mon, 2 Jan 2006 14:26:16 -0800, "Harlan Grove" wrote:
"Ron Rosenfeld" wrote... ... How about a negative look-behind assertion? =REGEX.MID($A$1,".*?(?<!FP)(K|$)",ROWS($B$2:B2 )) I keep forgetting Longre uses PCRE rather than VBScript regexp syntax. Too many regexp varieties. That should work for one literal substring in the assertion, but multiple options, e.g., ".+?(?<!(FP|XYZ|D))K" [note: it's more efficient to append a K to A1 and use a simple K at the end of the regexp than to use (K|$) - to me at least that's a clearer indicator that trailing symbols after the last K should be included] could cause backtracking problems. Assertions with alternation subexpressions with closures (not the case here, but generally) can become a big PITA. If there were multiple prohibited sequences, it may be more efficient to mask immediately following cut characters and replace them in the results. This is the regexp analog to using ancillary cells for intermediate calculations rather than single huge formulas in spreadsheets. Just as 2 or 3 formulas may recalc more quickly than a single equivalent formula, 2 or 3 simpler regexp operations may recalc more quickly than a single, more complex one. Assertions may work well in this case, but I tend to avoid them when possible myself. I will need to keep that in mind. Clearly I have insufficient experience with regular expressions to have run into some of the issues you have mentioned. I will need to think more about the backtracking issues in order to better understand what you write. As well as the pros and cons of trying to avoid assertions. I have been trying to work out some of the questions posed on the NG's you referred me to. Educational. Thanks. Best wishes and Happy New Year, --ron --ron |
#34
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Ron Rosenfeld wrote...
.... I will need to keep that in mind. Clearly I have insufficient experience with regular expressions to have run into some of the issues you have mentioned. I will need to think more about the backtracking issues in order to better understand what you write. As well as the pros and cons of trying to avoid assertions. .... If you want to get a real grounding in regular expressions, read Jeffrey Friedl's book 'Mastering Regular Expressions, 2nd Ed.', ISBN 0-596-00289-0. Lots of discussion about backtracking and optimizing regular expessions. |
#35
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
On 2 Jan 2006 19:05:16 -0800, "Harlan Grove" wrote:
Ron Rosenfeld wrote... ... I will need to keep that in mind. Clearly I have insufficient experience with regular expressions to have run into some of the issues you have mentioned. I will need to think more about the backtracking issues in order to better understand what you write. As well as the pros and cons of trying to avoid assertions. ... If you want to get a real grounding in regular expressions, read Jeffrey Friedl's book 'Mastering Regular Expressions, 2nd Ed.', ISBN 0-596-00289-0. Lots of discussion about backtracking and optimizing regular expessions. Thanks. Just ordered a copy from Amazon. --ron |
#36
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]()
Thank you Harlan Grove!
In fact, this solve my first "problem" related to this kind of text manipulation. However, now I have to specify in such VBA code that the sequence could be cut after or before two or more letters simultaneously. Example: The sequence is IADASFDTYEREPWQNMSDFGHKEASADSASSASADRASERAS cut after K or R 0 lost: IADASFDTYER EPWQNMSDFGHK EASADSASSASADR SER AS 1 lost cut: IADASFDTYEREPWQNMSDFGHK EPWQNMSDFGHKEASADSASSASADR EASADSASSASADRSER SERAS ...... Harlan Grove wrote: Bob Phillips wrote... ... If nIndex = 1 Then Cells(i, "A").Value = Right(Cells(i, "A").Value, _ Len(Cells(i, "A").Value) - 1) Else Cells(i, "A").Value = Left(Cells(i, "A").Value, nIndex - 1) & _ Right(Cells(i, "A").Value, Len(Cells(i, "A").Value) - nIndex) End If ... Could simplify: Right(x, Len(x) - y) == Mid(x, y + 1) Then again, the whole If block could be replaced by Cells(i, "A").Value = _ Application.WorksheetFunction.Replace(Cells(i, "A").Value, nIndex, 1, "") |
#37
![]()
Posted to microsoft.public.excel.worksheet.functions
|
|||
|
|||
![]() paulinoluciano wrote: Thank you Harlan Grove! In fact, this solve my first "problem" related to this kind of text manipulation. However, now I have to specify in such VBA code that the sequence could be cut after or before two or more letters simultaneously. Example: The sequence is IADASFDTYEREPWQNMSDFGHKEASADSASSASADRASERAS cut after K or R 0 lost: IADASFDTYER EPWQNMSDFGHK EASADSASSASADR SER AS 1 lost cut: IADASFDTYEREPWQNMSDFGHK EPWQNMSDFGHKEASADSASSASADR EASADSASSASADRSER SERAS ..... Harlan Grove wrote: Bob Phillips wrote... ... If nIndex = 1 Then Cells(i, "A").Value = Right(Cells(i, "A").Value, _ Len(Cells(i, "A").Value) - 1) Else Cells(i, "A").Value = Left(Cells(i, "A").Value, nIndex - 1) & _ Right(Cells(i, "A").Value, Len(Cells(i, "A").Value) - nIndex) End If ... Could simplify: Right(x, Len(x) - y) == Mid(x, y + 1) Then again, the whole If block could be replaced by Cells(i, "A").Value = _ Application.WorksheetFunction.Replace(Cells(i, "A").Value, nIndex, 1, "") |
Reply |
Thread Tools | Search this Thread |
Display Modes | |
|
|
![]() |
||||
Thread | Forum | |||
Using Concatenate function to generate text in Text Box | Charts and Charting in Excel | |||
merged cells into one text cell, size varies dependant on text dat | Excel Discussion (Misc queries) | |||
Text shown up in other cells everytime a text is entered in 1 cell | Excel Discussion (Misc queries) | |||
SUMPRODUCT vs Text??? | Excel Worksheet Functions | |||
Read Text File into Excel Using VBA | Excel Discussion (Misc queries) |